PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca53705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 311aa    MW: 34392 Da    PI: 7.2318
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca53705.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.23.9e-17192226135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Dca53705.1 192 CLHCAAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 226
                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.2E-771285IPR016679Transcription factor, GATA, plant
SMARTSM004017.1E-17186236IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.82186222IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.8E-14188223IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-15188250No hitNo description
CDDcd002022.48E-12191238No hitNo description
PROSITE patternPS003440192217IPR000679Zinc finger, GATA-type
PfamPF003207.4E-15192226IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEGADFFVEG LLDFSNGGDD MMTDTFFHSG DSSATLTPVS DSCNSSGSGG RPSSFPDSHF  60
SSDLCVPCDE LEELEWLSNF VEESFSTEEL HKFHLIPTQP SPAQYPLQAH NPNSTHQNPS  120
TVPGKARSKR SRVPPCDWST RLLMVSNPTQ TQTQAQSPAT SSSSGQSSGQ KKTVKRREAG  180
PGGEGDGEAR RCLHCAAEKT PQWRTGPMGP KTLCNACGVR YKSGRLVPEY RPAASPTFVS  240
AKHSNSHRKV MELRRQKEVQ MPLNQHSHFL GHQQQHQHHH HHQSMMMGAP NGGDDYLIHH  300
HLAHDYRQML S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691426.11e-109PREDICTED: GATA transcription factor 12-like
SwissprotP697812e-77GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0K9QVQ61e-112A0A0K9QVQ6_SPIOL; Uncharacterized protein
STRINGVIT_09s0002g03750.t011e-102(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-66GATA transcription factor 12